PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00146615001
Common NameGSBRNA2T00146615001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 803aa    MW: 89636.5 Da    PI: 6.275
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00146615001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.81.3e-29540591152
               RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  GSBRNA2T00146615001 540 AEKNITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 591
                          589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.052528611IPR003035RWP-RK domain
PfamPF020421.2E-25543591IPR003035RWP-RK domain
SuperFamilySSF542778.83E-23694790No hitNo description
SMARTSM006661.8E-24704787IPR000270PB1 domain
PROSITE profilePS5174529.203704787IPR000270PB1 domain
PfamPF005641.6E-17705785IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.9E-19705784No hitNo description
CDDcd064071.83E-36705781No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 803 aa     Download sequence    Send to blast
MNNNYHLPMD PAMDSSFMDG LLLDGCWLET TTTDASEFPN FSPSTSLAPF DPSSFMWSPQ  60
QDNTAAISSS TLSHMYGQGF AERSSLEDLS TLNRRFWIGP SGGGHGSSVM ERLVQAVKHI  120
KDFTSERGDS LIQLWVPVDR GGKRVLTTKE QPFSHDPMSQ RLAHYREISE NYQFSAEQED  180
SSSKDLVGLP GRVFLGQVPE WTPDVRFFKN EEYPRVQHAQ DCDVRGTLAI PVFEQGSKTC  240
LGVIEVVMTT QMVKLSPELD SICRALQAVD LRSTEVPVSP SLKGPDFSYQ AALPEIRNLL  300
RCACETHKLP LAQTWMSCLK QSKTGCRHND HNYIHCVSTI DDACYVGDPT VREFHEACSE  360
HHLLKGQGVV GEAFLTNGPC FSSDVSSYKK SEYPLSHHAT MFGLHGTVAI RLRCIHTGSA  420
DFVLEFFLPK DCRDIEEQRR MLNALSTIMA HVPRSLRTVT EKELEEEGDQ MVSEVETLPK  480
IEETCEVHES NSNPQHVGLS VDGEIGFDYG KGVSVVNENS TFSSAGGGSS RVTEKKKTKA  540
EKNITLDVLR QYFAGSLKDA AKSIGVCPTT LKRICRQHGI QRWPSRKIKK VGHSLQKIQR  600
VIDSVQGVSG HHLPIGSFYA NFPNLASSQE QQSKQTTFLP SSSHSQPAKS SSPGSSCSHT  660
SSCSSETQAN KEDPVNKARE DTRAIKQTQT TQLSPSTSSQ EDDFLRVKVS YEEEKIRFRM  720
RNSRRLKDLL WEIAKRFSIE DVSRYDLKYL DEDNEWVLLR CDDDVEECVD VCRSFPGETI  780
KLLLQLSSQH LQERSSVSGS LS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.265493e-49leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00146615001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009106294.10.0PREDICTED: protein NLP5 isoform X1
RefseqXP_013717982.10.0PREDICTED: protein NLP5-like isoform X1
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLA0A078DEG40.0A0A078DEG4_BRANA; BnaA07g32630D protein
STRINGBra015758.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]